Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (14 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry) |
Domain d4dxek_: 4dxe K: [240084] Other proteins in same PDB: d4dxea_, d4dxeb_, d4dxec_, d4dxed_, d4dxee_, d4dxef_ automated match to d3gzmb_ complexed with mli |
PDB Entry: 4dxe (more details), 2.51 Å
SCOPe Domain Sequences for d4dxek_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxek_ a.28.1.0 (K:) automated matches {Staphylococcus aureus [TaxId: 93062]} amenfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdeea ekintvgdavkfinsl
Timeline for d4dxek_: