SCOPe 2.08: Domain d4dxek1: 4dxe K:1-75

Lineage for d4dxek1 (4dxe K:1-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry)

8. Domain d4dxek1: 4dxe K:1-75 [240084]
   Other proteins in same PDB: d4dxea1, d4dxea2, d4dxeb1, d4dxeb2, d4dxec1, d4dxec2, d4dxed1, d4dxed2, d4dxee1, d4dxee2, d4dxef1, d4dxef2, d4dxeg2, d4dxeh2, d4dxei2, d4dxej2, d4dxek2, d4dxel2
   automated match to d3gzmb_
   complexed with mli

Details for d4dxek1

PDB Entry: 4dxe, 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col

PDB Compounds: (K:) Acyl carrier protein

SCOPe Domain Sequences for d4dxek1:

Sequence; same for both SEQRES and ATOM records:

>d4dxek1 a.28.1.0 (K:1-75) automated matches {Staphylococcus aureus [TaxId: 93062]}
menfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdeeae
kintvgdavkfinsl

Timeline for d4dxek1:

• d4dxek1 first appeared in SCOPe 2.04, called d4dxek_
  
• d4dxek1 appears in SCOPe 2.07