SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4dxei1 (4dxe I:1-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1991986Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1992102Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1992103Protein automated matches [191038] (19 species)
    not a true protein
  7. 1992141Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry)
  8. 1992144Domain d4dxei1: 4dxe I:1-75 [240082]
    Other proteins in same PDB: d4dxea1, d4dxea2, d4dxeb1, d4dxeb2, d4dxec1, d4dxec2, d4dxed1, d4dxed2, d4dxee1, d4dxee2, d4dxef1, d4dxef2, d4dxeg2, d4dxeh2, d4dxei2, d4dxej2, d4dxek2, d4dxel2
    automated match to d3gzmb_
    complexed with mli

Details for d4dxei1

PDB Entry: 4dxe (more details), 2.51 Å

PDB Description: 2.52 Angstrom resolution crystal structure of the acyl-carrier-protein synthase (AcpS)-acyl carrier protein (ACP) protein-protein complex from Staphylococcus aureus subsp. aureus COL
PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d4dxei1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxei1 a.28.1.0 (I:1-75) automated matches {Staphylococcus aureus [TaxId: 93062]}
menfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdeeae
kintvgdavkfinsl

SCOPe Domain Coordinates for d4dxei1:

Click to download the PDB-style file with coordinates for d4dxei1.
(The format of our PDB-style files is described here.)

Timeline for d4dxei1: