Lineage for d4dxeh1 (4dxe H:1-73)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706365Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry)
  8. 2706367Domain d4dxeh1: 4dxe H:1-73 [240081]
    Other proteins in same PDB: d4dxea1, d4dxea2, d4dxeb1, d4dxeb2, d4dxec1, d4dxec2, d4dxed1, d4dxed2, d4dxee1, d4dxee2, d4dxef1, d4dxef2, d4dxeg2, d4dxeh2, d4dxei2, d4dxej2, d4dxek2, d4dxel2
    automated match to d3gzmb_
    complexed with mli

Details for d4dxeh1

PDB Entry: 4dxe (more details), 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col
PDB Compounds: (H:) Acyl carrier protein

SCOPe Domain Sequences for d4dxeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxeh1 a.28.1.0 (H:1-73) automated matches {Staphylococcus aureus [TaxId: 93062]}
menfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdeeae
kintvgdavkfin

SCOPe Domain Coordinates for d4dxeh1:

Click to download the PDB-style file with coordinates for d4dxeh1.
(The format of our PDB-style files is described here.)

Timeline for d4dxeh1: