SCOPe 2.08: Domain d4dk3b1: 4dk3 B:1-126

Lineage for d4dk3b1 (4dk3 B:1-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4dk3b1: 4dk3 B:1-126 [240077]
   Other proteins in same PDB: d4dk3a2, d4dk3b2
   automated match to d4dk3a_
   protein/RNA complex

Details for d4dk3b1

PDB Entry: 4dk3, 2.76 Å

PDB Description: structure of editosome protein

PDB Compounds: (B:) single domain antibody VHH

SCOPe Domain Sequences for d4dk3b1:

Sequence; same for both SEQRES and ATOM records:

>d4dk3b1 b.1.1.1 (B:1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
tqvtvs

Timeline for d4dk3b1:

• d4dk3b1 first appeared in SCOPe 2.04, called d4dk3b_
  
• d4dk3b1 appears in SCOPe 2.07