![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries) |
![]() | Domain d4dj8f_: 4dj8 F: [240076] Other proteins in same PDB: d4dj8a_, d4dj8c_, d4dj8e1, d4dj8e2 automated match to d4n5zb_ complexed with nag, sia |
PDB Entry: 4dj8 (more details), 2.8 Å
SCOPe Domain Sequences for d4dj8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dj8f_ h.3.1.1 (F:) automated matches {Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqn
Timeline for d4dj8f_: