Lineage for d4dj8b_ (4dj8 B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709764Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)
  8. 1709768Domain d4dj8b_: 4dj8 B: [240074]
    Other proteins in same PDB: d4dj8a_, d4dj8c_, d4dj8e_
    automated match to d4n5zb_
    complexed with nag, sia

Details for d4dj8b_

PDB Entry: 4dj8 (more details), 2.8 Å

PDB Description: structure of the hemagglutinin complexed with 6sln from a highly pathogenic h7n7 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4dj8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj8b_ h.3.1.1 (B:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnr

SCOPe Domain Coordinates for d4dj8b_:

Click to download the PDB-style file with coordinates for d4dj8b_.
(The format of our PDB-style files is described here.)

Timeline for d4dj8b_: