SCOPe 2.05: Domain d4dj7b_: 4dj7 B:

Lineage for d4dj7b_ (4dj7 B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)

8. Domain d4dj7b_: 4dj7 B: [240071]
   Other proteins in same PDB: d4dj7a_, d4dj7c_, d4dj7e_
   automated match to d4n5zb_
   complexed with nag

Details for d4dj7b_

PDB Entry: 4dj7, 2.81 Å

PDB Description: structure of the hemagglutinin complexed with 3sln from a highly pathogenic h7n7 influenza virus

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4dj7b_:

Sequence; same for both SEQRES and ATOM records:

>d4dj7b_ h.3.1.1 (B:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnr

Timeline for d4dj7b_:

• d4dj7b_ first appeared in SCOPe 2.04
  
• d4dj7b_ appears in SCOPe 2.06
  
• d4dj7b_ appears in the current release, SCOPe 2.08