SCOPe 2.05: Domain d1cesb_: 1ces B:

Lineage for d1cesb_ (1ces B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (56 PDB entries)
   Uniprot P81461

8. Domain d1cesb_: 1ces B: [24007]
   complexed with zn

Details for d1cesb_

PDB Entry: 1ces, 2.7 Å

PDB Description: crystals of demetallized concanavalin a soaked with zinc have a zinc ion bound in the s1 site

PDB Compounds: (B:) concanavalin a

SCOPe Domain Sequences for d1cesb_:

Sequence, based on SEQRES records:

>d1cesb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records):

>d1cesb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavv
sypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetna
lhfmfnqfskdqkdlilqgdattgtdgnleltrvsssvgralfyapvhiwessavvasfe
atftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1cesb_:

• d1cesb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cesb_ appears in SCOPe 2.04
  
• d1cesb_ appears in SCOPe 2.06
  
• d1cesb_ appears in the current release, SCOPe 2.08