Lineage for d4dj6d_ (4dj6 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646014Species Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)
  8. 2646016Domain d4dj6d_: 4dj6 D: [240069]
    Other proteins in same PDB: d4dj6a_, d4dj6c_, d4dj6e1, d4dj6e2
    automated match to d4n5zb_
    complexed with nag

Details for d4dj6d_

PDB Entry: 4dj6 (more details), 2.61 Å

PDB Description: structure of the hemagglutinin from a highly pathogenic h7n7 influenza virus
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4dj6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj6d_ h.3.1.1 (D:) automated matches {Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnri

SCOPe Domain Coordinates for d4dj6d_:

Click to download the PDB-style file with coordinates for d4dj6d_.
(The format of our PDB-style files is described here.)

Timeline for d4dj6d_: