SCOPe 2.05: Domain d4dj6d_: 4dj6 D:

Lineage for d4dj6d_ (4dj6 D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)

8. Domain d4dj6d_: 4dj6 D: [240069]
   Other proteins in same PDB: d4dj6a_, d4dj6c_, d4dj6e_
   automated match to d4n5zb_
   complexed with nag

Details for d4dj6d_

PDB Entry: 4dj6, 2.61 Å

PDB Description: structure of the hemagglutinin from a highly pathogenic h7n7 influenza virus

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4dj6d_:

Sequence; same for both SEQRES and ATOM records:

>d4dj6d_ h.3.1.1 (D:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnri

Timeline for d4dj6d_:

• d4dj6d_ first appeared in SCOPe 2.04
  
• d4dj6d_ appears in SCOPe 2.06
  
• d4dj6d_ appears in the current release, SCOPe 2.08