Lineage for d4dj6b_ (4dj6 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041522Species Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [256234] (3 PDB entries)
  8. 3041523Domain d4dj6b_: 4dj6 B: [240068]
    Other proteins in same PDB: d4dj6a_, d4dj6c_, d4dj6e1, d4dj6e2
    automated match to d4n5zb_
    complexed with nag

Details for d4dj6b_

PDB Entry: 4dj6 (more details), 2.61 Å

PDB Description: structure of the hemagglutinin from a highly pathogenic h7n7 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4dj6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj6b_ h.3.1.1 (B:) automated matches {Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnr

SCOPe Domain Coordinates for d4dj6b_:

Click to download the PDB-style file with coordinates for d4dj6b_.
(The format of our PDB-style files is described here.)

Timeline for d4dj6b_: