Lineage for d4dipj_ (4dip J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941753Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)
  8. 2941769Domain d4dipj_: 4dip J: [240067]
    Other proteins in same PDB: d4dipa2, d4dipb2, d4dipi2
    automated match to d4dipa_
    complexed with na, po4

Details for d4dipj_

PDB Entry: 4dip (more details), 1.82 Å

PDB Description: Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
PDB Compounds: (J:) Peptidyl-prolyl cis-trans isomerase FKBP14

SCOPe Domain Sequences for d4dipj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dipj_ d.26.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
galipepevkievlqkpfichrktkggdlmlvhyegylekdgslfhsthkhnngqpiwft
lgilealkgwdqglkgmcvgekrkliippalgygkegkgkippestlifnidlleirng

SCOPe Domain Coordinates for d4dipj_:

Click to download the PDB-style file with coordinates for d4dipj_.
(The format of our PDB-style files is described here.)

Timeline for d4dipj_: