![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries) |
![]() | Domain d4dipj_: 4dip J: [240067] Other proteins in same PDB: d4dipa2, d4dipb2, d4dipi2 automated match to d4dipa_ complexed with na, po4 |
PDB Entry: 4dip (more details), 1.82 Å
SCOPe Domain Sequences for d4dipj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dipj_ d.26.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} galipepevkievlqkpfichrktkggdlmlvhyegylekdgslfhsthkhnngqpiwft lgilealkgwdqglkgmcvgekrkliippalgygkegkgkippestlifnidlleirng
Timeline for d4dipj_: