Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (17 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries) |
Domain d4dhji_: 4dhj I: [240061] Other proteins in same PDB: d4dhjb_, d4dhjc_, d4dhjd_, d4dhjf_, d4dhjg_, d4dhjh_, d4dhjj_, d4dhjk_, d4dhjm_, d4dhjn_ automated match to d4i6la_ |
PDB Entry: 4dhj (more details), 2.35 Å
SCOPe Domain Sequences for d4dhji_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhji_ d.3.1.0 (I:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} deqksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgncfyrailv glieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekihsgvhteea vytilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeiepmwkdadh lainslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpghydviykkd s
Timeline for d4dhji_: