SCOPe 2.05: Domain d4dhje_: 4dhj E:

Lineage for d4dhje_ (4dhj E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries)

8. Domain d4dhje_: 4dhj E: [240060]
   Other proteins in same PDB: d4dhjb_, d4dhjc_, d4dhjd_, d4dhjf_, d4dhjg_, d4dhjh_, d4dhjj_, d4dhjk_, d4dhjm_, d4dhjn_
   automated match to d4i6la_

Details for d4dhje_

PDB Entry: 4dhj, 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex

PDB Compounds: (E:) Ubiquitin thioesterase otubain-like

SCOPe Domain Sequences for d4dhje_:

Sequence; same for both SEQRES and ATOM records:

>d4dhje_ d.3.1.0 (E:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lktiedeqksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgncfy
railvglieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekihsgv
hteeavytilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeiepmw
kdadhlainslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpghydv
iykkd

Timeline for d4dhje_:

• d4dhje_ first appeared in SCOPe 2.04
  
• d4dhje_ appears in SCOPe 2.06
  
• d4dhje_ appears in the current release, SCOPe 2.08