Lineage for d4dhja_ (4dhj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889773Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1889774Protein automated matches [190230] (17 species)
    not a true protein
  7. 1889860Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries)
  8. 1889862Domain d4dhja_: 4dhj A: [240059]
    Other proteins in same PDB: d4dhjb_, d4dhjc_, d4dhjd_, d4dhjf_, d4dhjg_, d4dhjh_, d4dhjj_, d4dhjk_, d4dhjm_, d4dhjn_
    automated match to d4i6la_

Details for d4dhja_

PDB Entry: 4dhj (more details), 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
PDB Compounds: (A:) Ubiquitin thioesterase otubain-like

SCOPe Domain Sequences for d4dhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhja_ d.3.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dqqlktiedeqksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgn
cfyrailvglieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekih
sgvhteeavytilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeie
pmwkdadhlainslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpgh
ydviykkd

SCOPe Domain Coordinates for d4dhja_:

Click to download the PDB-style file with coordinates for d4dhja_.
(The format of our PDB-style files is described here.)

Timeline for d4dhja_: