Lineage for d4dhib_ (4dhi B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927778Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries)
  8. 2927779Domain d4dhib_: 4dhi B: [240058]
    Other proteins in same PDB: d4dhid_
    automated match to d4i6la_

Details for d4dhib_

PDB Entry: 4dhi (more details), 1.8 Å

PDB Description: Structure of C. elegans OTUB1 bound to human UBC13
PDB Compounds: (B:) Ubiquitin thioesterase otubain-like

SCOPe Domain Sequences for d4dhib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhib_ d.3.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgncfyrailvgl
ieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekihsgvhteeavy
tilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeiepmwkdadhla
inslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpghydviykkd

SCOPe Domain Coordinates for d4dhib_:

Click to download the PDB-style file with coordinates for d4dhib_.
(The format of our PDB-style files is described here.)

Timeline for d4dhib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4dhid_