![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries) |
![]() | Domain d4dhib_: 4dhi B: [240058] Other proteins in same PDB: d4dhid_ automated match to d4i6la_ |
PDB Entry: 4dhi (more details), 1.8 Å
SCOPe Domain Sequences for d4dhib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhib_ d.3.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} qksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgncfyrailvgl ieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekihsgvhteeavy tilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeiepmwkdadhla inslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpghydviykkd
Timeline for d4dhib_: