SCOPe 2.08: Domain d4dfed2: 4dfe D:186-329

Lineage for d4dfed2 (4dfe D:186-329)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226295] (2 PDB entries)

8. Domain d4dfed2: 4dfe D:186-329 [240057]
   complexed with edo

Details for d4dfed2

PDB Entry: 4dfe, 2.35 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase III from Burkholderia xenovorans

PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4dfed2:

Sequence; same for both SEQRES and ATOM records:

>d4dfed2 c.95.1.0 (D:186-329) automated matches {Burkholderia xenovorans [TaxId: 266265]}
lasalhadgshsnilctpgnvnggvvsgsaflhmdgqavfklavnvlekvavealekanl
saeqidwliphqanirimqstcrklglpqermivtvgehgntsaasiplaldvavrdgri
krgqnvliegvgggftwgasviry

Timeline for d4dfed2:

• d4dfed2 first appeared in SCOPe 2.04
  
• d4dfed2 appears in SCOPe 2.07