Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226295] (2 PDB entries) |
Domain d4dfeb2: 4dfe B:186-329 [240053] complexed with edo |
PDB Entry: 4dfe (more details), 2.35 Å
SCOPe Domain Sequences for d4dfeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dfeb2 c.95.1.0 (B:186-329) automated matches {Burkholderia xenovorans [TaxId: 266265]} lasalhadgshsnilctpgnvnggvvsgsaflhmdgqavfklavnvlekvavealekanl saeqidwliphqanirimqstcrklglpqermivtvgehgntsaasiplaldvavrdgri krgqnvliegvgggftwgasviry
Timeline for d4dfeb2: