Lineage for d4dfeb2 (4dfe B:186-329)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917507Species Burkholderia xenovorans [TaxId:266265] [226295] (2 PDB entries)
  8. 2917513Domain d4dfeb2: 4dfe B:186-329 [240053]
    complexed with edo

Details for d4dfeb2

PDB Entry: 4dfe (more details), 2.35 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase III from Burkholderia xenovorans
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4dfeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dfeb2 c.95.1.0 (B:186-329) automated matches {Burkholderia xenovorans [TaxId: 266265]}
lasalhadgshsnilctpgnvnggvvsgsaflhmdgqavfklavnvlekvavealekanl
saeqidwliphqanirimqstcrklglpqermivtvgehgntsaasiplaldvavrdgri
krgqnvliegvgggftwgasviry

SCOPe Domain Coordinates for d4dfeb2:

Click to download the PDB-style file with coordinates for d4dfeb2.
(The format of our PDB-style files is described here.)

Timeline for d4dfeb2: