Lineage for d4dfea1 (4dfe A:5-185)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (62 species)
    not a true protein
  7. 2489176Species Burkholderia xenovorans [TaxId:266265] [226295] (2 PDB entries)
  8. 2489179Domain d4dfea1: 4dfe A:5-185 [240050]
    complexed with edo

Details for d4dfea1

PDB Entry: 4dfe (more details), 2.35 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase III from Burkholderia xenovorans
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4dfea1:

Sequence, based on SEQRES records: (download)

>d4dfea1 c.95.1.0 (A:5-185) automated matches {Burkholderia xenovorans [TaxId: 266265]}
tiysrvlgtgsylppnrvtnqdlakrlaeqgietsdewivartgiharyfaepdvttsdl
afiasqraieaadidpqsidliivatstpdfvfpstacllqnklgirnhgaafdvqavcs
gfayavatadsfirsgqhrtalvigaetfsrildfkdrttcvlfgdgagavilqasdepg
v

Sequence, based on observed residues (ATOM records): (download)

>d4dfea1 c.95.1.0 (A:5-185) automated matches {Burkholderia xenovorans [TaxId: 266265]}
tiysrvlgtgsylppnrvtnqdlakrlaietsdewivartgiharyfaepdvttsdlafi
asqraieaadidpqsidliivatstpdfvfpstacllqnklgirnhgaafdvqavcsgfa
yavatadsfirsgqhrtalvigaetfsrildfkdrttcvlfgdgagavilqasdepgv

SCOPe Domain Coordinates for d4dfea1:

Click to download the PDB-style file with coordinates for d4dfea1.
(The format of our PDB-style files is described here.)

Timeline for d4dfea1: