Lineage for d4c2mk_ (4c2m K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2565033Family d.74.3.0: automated matches [254324] (1 protein)
    not a true family
  6. 2565034Protein automated matches [254742] (3 species)
    not a true protein
  7. 2565035Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256218] (2 PDB entries)
  8. 2565036Domain d4c2mk_: 4c2m K: [240045]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_
    automated match to d1twfk_
    complexed with so4, zn

Details for d4c2mk_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (K:) DNA-directed RNA polymerases I and III subunit rpac2

SCOPe Domain Sequences for d4c2mk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mk_ d.74.3.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsenll
niriqtygettavdalqkglkdlmdlcdvveskftekiksm

SCOPe Domain Coordinates for d4c2mk_:

Click to download the PDB-style file with coordinates for d4c2mk_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mk_: