| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.0: automated matches [254324] (1 protein) not a true family |
| Protein automated matches [254742] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256218] (2 PDB entries) |
| Domain d4c2mk_: 4c2m K: [240045] Other proteins in same PDB: d4c2m1_, d4c2me1, d4c2me2, d4c2mf_, d4c2mh_, d4c2mj_, d4c2ml_, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mw_, d4c2my_ automated match to d1twfk_ complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mk_ d.74.3.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsenll
niriqtygettavdalqkglkdlmdlcdvveskftekiksm
Timeline for d4c2mk_: