Lineage for d4bsib_ (4bsi B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970216Species Influenza virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId:265120] [256215] (1 PDB entry)
  8. 1970217Domain d4bsib_: 4bsi B: [240042]
    Other proteins in same PDB: d4bsia_
    automated match to d1rd8b_
    complexed with nag, so4

Details for d4bsib_

PDB Entry: 4bsi (more details), 2.62 Å

PDB Description: h7n3 avian influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bsib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsib_ h.3.1.1 (B:) automated matches {Influenza virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId: 265120]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr

SCOPe Domain Coordinates for d4bsib_:

Click to download the PDB-style file with coordinates for d4bsib_.
(The format of our PDB-style files is described here.)

Timeline for d4bsib_: