Lineage for d4bshb_ (4bsh B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267427Species Influenza a virus (a/turkey/italy/214845/2002(h7n3)) [TaxId:265120] [256216] (1 PDB entry)
  8. 2267428Domain d4bshb_: 4bsh B: [240041]
    Other proteins in same PDB: d4bsha_
    automated match to d1rd8b_
    complexed with nag, so4

Details for d4bshb_

PDB Entry: 4bsh (more details), 2.25 Å

PDB Description: H7N3 Avian Influenza Virus Haemagglutinin in Complex with Human Receptor Analogue 6'-SLN
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bshb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/turkey/italy/214845/2002(h7n3)) [TaxId: 265120]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr

SCOPe Domain Coordinates for d4bshb_:

Click to download the PDB-style file with coordinates for d4bshb_.
(The format of our PDB-style files is described here.)

Timeline for d4bshb_: