SCOPe 2.05: Domain d4bshb_: 4bsh B:

Lineage for d4bshb_ (4bsh B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/turkey/italy/214845/2002(h7n3)) [TaxId:265120] [256216] (1 PDB entry)

8. Domain d4bshb_: 4bsh B: [240041]
   Other proteins in same PDB: d4bsha_
   automated match to d1rd8b_
   complexed with nag, so4

Details for d4bshb_

PDB Entry: 4bsh, 2.25 Å

PDB Description: h7n3 avian influenza virus haemagglutinin in complex with human receptor analogue 6'-sln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bshb_:

Sequence; same for both SEQRES and ATOM records:

>d4bshb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/turkey/italy/214845/2002(h7n3)) [TaxId: 265120]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr

Timeline for d4bshb_:

• d4bshb_ first appeared in SCOPe 2.04
  
• d4bshb_ appears in SCOPe 2.06
  
• d4bshb_ appears in the current release, SCOPe 2.08