SCOPe 2.06: Domain d4bsgb_: 4bsg B:

Lineage for d4bsgb_ (4bsg B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza a virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId:265120] [256217] (1 PDB entry)

8. Domain d4bsgb_: 4bsg B: [240040]
   Other proteins in same PDB: d4bsga_
   automated match to d1rd8b_
   complexed with nag, so4

Details for d4bsgb_

PDB Entry: 4bsg, 2.1 Å

PDB Description: crystal structure of an h7n3 avian influenza virus haemagglutinin

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bsgb_:

Sequence; same for both SEQRES and ATOM records:

>d4bsgb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId: 265120]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr

Timeline for d4bsgb_:

• d4bsgb_ first appeared in SCOPe 2.04
  
• d4bsgb_ appears in SCOPe 2.05
  
• d4bsgb_ appears in SCOPe 2.07
  
• d4bsgb_ appears in the current release, SCOPe 2.08