Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus (a/turkey/italy/214845/2002(h7n3)) [TaxId:265120] [256216] (2 PDB entries) |
Domain d4bsgb_: 4bsg B: [240040] Other proteins in same PDB: d4bsga_ automated match to d1rd8b_ complexed with nag, so4 |
PDB Entry: 4bsg (more details), 2.1 Å
SCOPe Domain Sequences for d4bsgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsgb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/turkey/italy/214845/2002(h7n3)) [TaxId: 265120]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr
Timeline for d4bsgb_: