Lineage for d1vamc_ (1vam C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778302Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (74 PDB entries)
    Uniprot P81461
  8. 2778432Domain d1vamc_: 1vam C: [24004]
    complexed with ca, mn, pna

Details for d1vamc_

PDB Entry: 1vam (more details), 2.75 Å

PDB Description: concanavalin a complex with 4'-nitrophenyl-alpha-d-mannopyranoside
PDB Compounds: (C:) concanavalin a

SCOPe Domain Sequences for d1vamc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vamc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1vamc_:

Click to download the PDB-style file with coordinates for d1vamc_.
(The format of our PDB-style files is described here.)

Timeline for d1vamc_: