SCOPe 2.08: Domain d4bsfb_: 4bsf B:

Lineage for d4bsfb_ (4bsf B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries)

8. Domain d4bsfb_: 4bsf B: [240039]
   Other proteins in same PDB: d4bsfa_
   automated match to d4n5zb_
   complexed with nag, so4

Details for d4bsfb_

PDB Entry: 4bsf, 2.76 Å

PDB Description: human h7n9 influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln

PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4bsfb_:

Sequence; same for both SEQRES and ATOM records:

>d4bsfb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4bsfb_:

• d4bsfb_ first appeared in SCOPe 2.04
  
• d4bsfb_ appears in SCOPe 2.07