![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (6 species) not a true protein |
![]() | Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries) |
![]() | Domain d4bseb_: 4bse B: [240038] Other proteins in same PDB: d4bsea_ automated match to d4n5zb_ complexed with nag, so4 |
PDB Entry: 4bse (more details), 2.55 Å
SCOPe Domain Sequences for d4bseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bseb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
Timeline for d4bseb_: