Lineage for d4bseb_ (4bse B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709924Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1709925Protein automated matches [254645] (6 species)
    not a true protein
  7. 1709954Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries)
  8. 1709959Domain d4bseb_: 4bse B: [240038]
    Other proteins in same PDB: d4bsea_
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4bseb_

PDB Entry: 4bse (more details), 2.55 Å

PDB Description: human h7n9 influenza virus haemagglutinin in complex with human receptor analogue lstc
PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4bseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bseb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4bseb_:

Click to download the PDB-style file with coordinates for d4bseb_.
(The format of our PDB-style files is described here.)

Timeline for d4bseb_: