Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (6 species) not a true protein |
Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries) |
Domain d4bsdb_: 4bsd B: [240037] Other proteins in same PDB: d4bsda_ automated match to d4n5zb_ complexed with nag, so4 |
PDB Entry: 4bsd (more details), 2.4 Å
SCOPe Domain Sequences for d4bsdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsdb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
Timeline for d4bsdb_: