Lineage for d4bsbb_ (4bsb B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646620Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries)
  8. 2646621Domain d4bsbb_: 4bsb B: [240035]
    Other proteins in same PDB: d4bsba_
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4bsbb_

PDB Entry: 4bsb (more details), 2.35 Å

PDB Description: human h7n9 influenza virus haemagglutinin (with asn-133 glycosylation) in complex with human receptor analogue lstc
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bsbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsbb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4bsbb_:

Click to download the PDB-style file with coordinates for d4bsbb_.
(The format of our PDB-style files is described here.)

Timeline for d4bsbb_: