SCOPe 2.04: Domain d4bsbb_: 4bsb B:

Lineage for d4bsbb_ (4bsb B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (6 species)
   not a true protein

7. Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [256214] (6 PDB entries)

8. Domain d4bsbb_: 4bsb B: [240035]
   Other proteins in same PDB: d4bsba_
   automated match to d4n5zb_
   complexed with nag, so4

Details for d4bsbb_

PDB Entry: 4bsb, 2.35 Å

PDB Description: human h7n9 influenza virus haemagglutinin (with asn-133 glycosylation) in complex with human receptor analogue lstc

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bsbb_:

Sequence; same for both SEQRES and ATOM records:

>d4bsbb_ h.3.1.0 (B:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4bsbb_:

• d4bsbb_ is new in SCOPe 2.04-stable
  
• d4bsbb_ appears in SCOPe 2.05
  
• d4bsbb_ appears in the current release, SCOPe 2.08