Lineage for d4bmsk_ (4bms K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848266Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2848308Domain d4bmsk_: 4bms K: [240031]
    automated match to d4bmsa_
    complexed with nap

Details for d4bmsk_

PDB Entry: 4bms (more details), 2.89 Å

PDB Description: Short chain alcohol dehydrogenase from Ralstonia sp. DSM 6428 in complex with NADPH
PDB Compounds: (K:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4bmsk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmsk_ c.2.1.0 (K:) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv

SCOPe Domain Coordinates for d4bmsk_:

Click to download the PDB-style file with coordinates for d4bmsk_.
(The format of our PDB-style files is described here.)

Timeline for d4bmsk_: