SCOPe 2.05: Domain d4blzb_: 4blz B:

Lineage for d4blzb_ (4blz B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (10 species)
   not a true protein

7. Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)

8. Domain d4blzb_: 4blz B: [240029]
   automated match to d4blka_
   complexed with ca, hem

Details for d4blzb_

PDB Entry: 4blz, 2 Å

PDB Description: crystal structure of fungal versatile peroxidase i from pleurotus ostreatus - crystal form vi

PDB Compounds: (B:) versatile peroxidase I

SCOPe Domain Sequences for d4blzb_:

Sequence; same for both SEQRES and ATOM records:

>d4blzb_ a.93.1.0 (B:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl
sdveqacaetpfpaltadpgpvtsvppvp

Timeline for d4blzb_:

• d4blzb_ first appeared in SCOPe 2.04
  
• d4blzb_ appears in SCOPe 2.06
  
• d4blzb_ appears in the current release, SCOPe 2.08