Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza virus [TaxId:284218] [256204] (3 PDB entries) |
Domain d4bh4b_: 4bh4 B: [240028] Other proteins in same PDB: d4bh4a1, d4bh4a2 automated match to d2fk0b1 complexed with epe, nag; mutant |
PDB Entry: 4bh4 (more details), 1.9 Å
SCOPe Domain Sequences for d4bh4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh4b_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 284218]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseear
Timeline for d4bh4b_: