SCOPe 2.07: Domain d4bh4b_: 4bh4 B:

Lineage for d4bh4b_ (4bh4 B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza virus [TaxId:284218] [256204] (3 PDB entries)

8. Domain d4bh4b_: 4bh4 B: [240028]
   Other proteins in same PDB: d4bh4a1, d4bh4a2
   automated match to d2fk0b1
   complexed with epe, nag; mutant

Details for d4bh4b_

PDB Entry: 4bh4, 1.9 Å

PDB Description: haemagglutinin from a transmissible mutant h5 influenza virus in complex with avian receptor analogue 3'-sln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bh4b_:

Sequence; same for both SEQRES and ATOM records:

>d4bh4b_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 284218]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseear

Timeline for d4bh4b_:

• d4bh4b_ first appeared in SCOPe 2.04
  
• d4bh4b_ appears in SCOPe 2.06
  
• d4bh4b_ appears in the current release, SCOPe 2.08