Lineage for d4bh2b_ (4bh2 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646351Species Influenza virus [TaxId:284218] [256204] (3 PDB entries)
  8. 2646354Domain d4bh2b_: 4bh2 B: [240026]
    Other proteins in same PDB: d4bh2a1, d4bh2a2
    automated match to d2fk0b1
    complexed with epe, nag; mutant

Details for d4bh2b_

PDB Entry: 4bh2 (more details), 2.12 Å

PDB Description: crystal structure of the haemagglutinin from a transmissible mutant h5 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bh2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh2b_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 284218]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseear

SCOPe Domain Coordinates for d4bh2b_:

Click to download the PDB-style file with coordinates for d4bh2b_.
(The format of our PDB-style files is described here.)

Timeline for d4bh2b_: