SCOPe 2.08: Domain d4bh2b_: 4bh2 B:

Lineage for d4bh2b_ (4bh2 B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza virus [TaxId:284218] [256204] (3 PDB entries)

8. Domain d4bh2b_: 4bh2 B: [240026]
   Other proteins in same PDB: d4bh2a1, d4bh2a2
   automated match to d2fk0b1
   complexed with epe, nag; mutant

Details for d4bh2b_

PDB Entry: 4bh2, 2.12 Å

PDB Description: crystal structure of the haemagglutinin from a transmissible mutant h5 influenza virus

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bh2b_:

Sequence; same for both SEQRES and ATOM records:

>d4bh2b_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 284218]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseear

Timeline for d4bh2b_:

• d4bh2b_ first appeared in SCOPe 2.04
  
• d4bh2b_ appears in SCOPe 2.07