Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (34 species) not a true protein |
Species Influenza a virus [TaxId:375457] [256202] (1 PDB entry) |
Domain d4bh1b_: 4bh1 B: [240023] Other proteins in same PDB: d4bh1a_, d4bh1c_, d4bh1e_ automated match to d2fk0b1 complexed with nag, po4 |
PDB Entry: 4bh1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bh1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh1b_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 375457]} ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn akelgngcfefyhrcdnecmesvrn
Timeline for d4bh1b_: