Lineage for d4bh0f_ (4bh0 F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709913Species Influenza virus [TaxId:375457] [256203] (2 PDB entries)
  8. 1709916Domain d4bh0f_: 4bh0 F: [240022]
    Other proteins in same PDB: d4bh0a_, d4bh0c_, d4bh0e_
    automated match to d2fk0b1
    complexed with nag, po4

Details for d4bh0f_

PDB Entry: 4bh0 (more details), 2.36 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4bh0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh0f_ h.3.1.1 (F:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrngty

SCOPe Domain Coordinates for d4bh0f_:

Click to download the PDB-style file with coordinates for d4bh0f_.
(The format of our PDB-style files is described here.)

Timeline for d4bh0f_: