Lineage for d4bgzf_ (4bgz F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970226Species Influenza virus [TaxId:375457] [256203] (2 PDB entries)
  8. 1970232Domain d4bgzf_: 4bgz F: [240019]
    Other proteins in same PDB: d4bgza_, d4bgzc_, d4bgze_
    automated match to d2fk0b1
    complexed with nag, po4

Details for d4bgzf_

PDB Entry: 4bgz (more details), 2.68 Å

PDB Description: crystal structure of h5 (tyty) influenza virus haemagglutinin
PDB Compounds: (F:) haemagglutinin ha1

SCOPe Domain Sequences for d4bgzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgzf_ h.3.1.1 (F:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrngty

SCOPe Domain Coordinates for d4bgzf_:

Click to download the PDB-style file with coordinates for d4bgzf_.
(The format of our PDB-style files is described here.)

Timeline for d4bgzf_: