| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (34 species) not a true protein |
| Species Influenza virus [TaxId:375457] [256203] (2 PDB entries) |
| Domain d4bgzb_: 4bgz B: [240017] Other proteins in same PDB: d4bgza_, d4bgzc_, d4bgze1, d4bgze2 automated match to d2fk0b1 complexed with nag, po4 |
PDB Entry: 4bgz (more details), 2.68 Å
SCOPe Domain Sequences for d4bgzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgzb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrn
Timeline for d4bgzb_: