Lineage for d4bgzb_ (4bgz B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041773Species Influenza virus [TaxId:375457] [256203] (2 PDB entries)
  8. 3041777Domain d4bgzb_: 4bgz B: [240017]
    Other proteins in same PDB: d4bgza_, d4bgzc_, d4bgze1, d4bgze2
    automated match to d2fk0b1
    complexed with nag, po4

Details for d4bgzb_

PDB Entry: 4bgz (more details), 2.68 Å

PDB Description: crystal structure of h5 (tyty) influenza virus haemagglutinin
PDB Compounds: (B:) haemagglutinin ha1

SCOPe Domain Sequences for d4bgzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgzb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 375457]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdn
akelgngcfefyhrcdnecmesvrn

SCOPe Domain Coordinates for d4bgzb_:

Click to download the PDB-style file with coordinates for d4bgzb_.
(The format of our PDB-style files is described here.)

Timeline for d4bgzb_: