Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza virus [TaxId:644788] [256201] (3 PDB entries) |
Domain d4bgyb_: 4bgy B: [240016] Other proteins in same PDB: d4bgya_ automated match to d2fk0b1 complexed with epe |
PDB Entry: 4bgy (more details), 2.68 Å
SCOPe Domain Sequences for d4bgyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgyb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy
Timeline for d4bgyb_: