SCOPe 2.07: Domain d4bgxb_: 4bgx B:

Lineage for d4bgxb_ (4bgx B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza virus [TaxId:644788] [256201] (3 PDB entries)

8. Domain d4bgxb_: 4bgx B: [240015]
   Other proteins in same PDB: d4bgxa_
   automated match to d2fk0b1
   complexed with epe, nag

Details for d4bgxb_

PDB Entry: 4bgx, 2.48 Å

PDB Description: h5 (vn1194) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bgxb_:

Sequence; same for both SEQRES and ATOM records:

>d4bgxb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

Timeline for d4bgxb_:

• d4bgxb_ first appeared in SCOPe 2.04
  
• d4bgxb_ appears in SCOPe 2.06
  
• d4bgxb_ appears in the current release, SCOPe 2.08