Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza virus [TaxId:644788] [256201] (3 PDB entries) |
Domain d4bgxb_: 4bgx B: [240015] Other proteins in same PDB: d4bgxa_ automated match to d2fk0b1 complexed with epe, nag |
PDB Entry: 4bgx (more details), 2.48 Å
SCOPe Domain Sequences for d4bgxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgxb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy
Timeline for d4bgxb_: