SCOPe 2.05: Domain d4bgwb_: 4bgw B:

Lineage for d4bgwb_ (4bgw B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza virus [TaxId:644788] [256201] (3 PDB entries)

8. Domain d4bgwb_: 4bgw B: [240014]
   Other proteins in same PDB: d4bgwa_
   automated match to d2fk0b1
   complexed with epe, nag

Details for d4bgwb_

PDB Entry: 4bgw, 2.48 Å

PDB Description: crystal structure of h5 (vn1194) influenza haemagglutinin

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4bgwb_:

Sequence; same for both SEQRES and ATOM records:

>d4bgwb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

Timeline for d4bgwb_:

• d4bgwb_ first appeared in SCOPe 2.04
  
• d4bgwb_ appears in SCOPe 2.06
  
• d4bgwb_ appears in the current release, SCOPe 2.08