![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza virus [TaxId:644788] [256201] (3 PDB entries) |
![]() | Domain d4bgwb_: 4bgw B: [240014] Other proteins in same PDB: d4bgwa_ automated match to d2fk0b1 complexed with epe, nag |
PDB Entry: 4bgw (more details), 2.48 Å
SCOPe Domain Sequences for d4bgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgwb_ h.3.1.1 (B:) automated matches {Influenza virus [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy
Timeline for d4bgwb_: