SCOPe 2.05: Domain d4bd7b_: 4bd7 B:

Lineage for d4bd7b_ (4bd7 B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (8 PDB entries)

8. Domain d4bd7b_: 4bd7 B: [240007]
   automated match to d4bd7a_
   complexed with cl, pr

Details for d4bd7b_

PDB Entry: 4bd7, 2.9 Å

PDB Description: Bax domain swapped dimer induced by octylmaltoside

PDB Compounds: (B:) Apoptosis regulator BAX

SCOPe Domain Sequences for d4bd7b_:

Sequence, based on SEQRES records:

>d4bd7b_ f.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseslkrigdeldsn
melqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpeli
rtimgwtldflrerllgwiqdqggwdgllsyfgtptw

Sequence, based on observed residues (ATOM records):

>d4bd7b_ f.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsseqimktgalllqgfiqdragapelaldpvpqdastkklseslkrigdeldsnmelqr
miaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimg
wtldflrerllgwiqdqggwdgllsyfgtptw

Timeline for d4bd7b_:

• d4bd7b_ first appeared in SCOPe 2.04
  
• d4bd7b_ appears in SCOPe 2.06
  
• d4bd7b_ appears in the current release, SCOPe 2.08