SCOPe 2.05: Domain d4bbhc1: 4bbh C:27-210

Lineage for d4bbhc1 (4bbh C:27-210)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (32 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [234134] (7 PDB entries)

8. Domain d4bbhc1: 4bbh C:27-210 [240006]
   automated match to d1iica1
   complexed with cl, dms, mg, nhw, so4, ybn

Details for d4bbhc1

PDB Entry: 4bbh, 1.63 Å

PDB Description: Plasmodium vivax N-myristoyltransferase with a bound benzothiophene inhibitor

PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4bbhc1:

Sequence; same for both SEQRES and ATOM records:

>d4bbhc1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

Timeline for d4bbhc1:

• d4bbhc1 first appeared in SCOPe 2.04
  
• d4bbhc1 appears in SCOPe 2.06
  
• d4bbhc1 appears in the current release, SCOPe 2.08